Blog

You can buy experimental Laser system for experiments in Wave Genetics and Torsion fields.

Music of Painting – Floating Islands in the Sky

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

How the picture sounds – Adele Angel Daniel B Holeman

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

meditation omtec – Subtle world noosphere of the planet

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

Translation of a picture to music – Olga Sheveleva

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

How the image sounds – Veil Nebula

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

Music from the Pleiades image

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

How the picture sings subtle worlds

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

Dna Music – How the Human GJB2 Gene Sings (translation mRNA)

Dna Music – How the Human GJB2 Gene Sings (translation mRNA)—————————–Translation into a melody from amino acid assembly sequences.The melody of the translation (assembly) of amino acids (proteins) from the mRNA template region of the human GJB2 gene—————————–Homo sapiens gap junction protein beta 2 (GJB2), mRNA/ gene = ”GJB2 ″/ Translation = “MDWGTLQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVW GDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEK KRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDG …

DNA Music – sequencing protein telomerase reverse transcriptase isoform 2 [Homo sapiens]

Transfer to the melody of the amino acid assembly sequence of the sequencing protein telomerase reverse transcriptase isoform 2 [Homo sapiens]