Category: MUSIC OF THE GENOME – MUSIC DNA

You can buy experimental Laser system for experiments in Wave Genetics and Torsion fields.

Dna Music – How the Human GJB2 Gene Sings (translation mRNA)

Dna Music – How the Human GJB2 Gene Sings (translation mRNA)—————————–Translation into a melody from amino acid assembly sequences.The melody of the translation (assembly) of amino acids (proteins) from the mRNA template region of the human GJB2 gene—————————–Homo sapiens gap junction protein beta 2 (GJB2), mRNA/ gene = ”GJB2 ″/ Translation = “MDWGTLQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVW GDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEK KRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDG …

DNA Music – sequencing protein telomerase reverse transcriptase isoform 2 [Homo sapiens]

Transfer to the melody of the amino acid assembly sequence of the sequencing protein telomerase reverse transcriptase isoform 2 [Homo sapiens]

DNA Music – sequencing protein TSPO transcript

Transfer to the melody of the amino acid assembly sequence of the sequencing protein TSPO transcript

DNA Music – Homo sapiens myelin basic protein (MBP), transcript variant 1, translation

Transfer to the melody of the amino acid assembly sequence of the basic myelin protein.A melody of translation (assembly) of amino acids (proteins) from the mRNA template region of the human MBP gene———————–

Genome Music – Barley cultivar OWB-D (R gene), partial cds

Translation on the assembly notes in the ribosome of proteins from the matrix mRNA of the Barley cultivar OWB-D (R gene), partial cds

Genome music (chloroplast) Indigofera cytisoides

Translation on the assembly notes in the ribosome of proteins from the matrix mRNA of the Indigofera cytisoides source https://www.ncbi.nlm.nih.gov/protein/AJP09288.1

Music DNA – Homo sapiens proteoglycan 2, pro eosinophil major basic protein

Translation on the assembly notes in the ribosome of proteins from the matrix mRNA of the Homo sapiens proteoglycan 2 gene, pro eosinophil major basic protein (PRG2), transcript variant 2, mRNAA sourcehttps://www.ncbi.nlm.nih.gov/nuccore/NM_001243245